SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427713547|ref|YP_007062171.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713547|ref|YP_007062171.1|
Domain Number 1 Region: 254-631
Classification Level Classification E-value
Superfamily SIS domain 6.06e-98
Family double-SIS domain 0.000000118
Further Details:      
 
Domain Number 2 Region: 2-243
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.86e-72
Family Class II glutamine amidotransferases 0.00000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427713547|ref|YP_007062171.1|
Sequence length 631
Comment glucosamine--fructose-6-phosphate aminotransferase [Synechococcus sp. PCC 6312]
Sequence
MCGIVGYIGPRPAAEVLLEGLRKLEYRGYDSAGIAAVWEGELHCIRAKGKLHNLQEKLEK
LHLPARIGIGHTRWATHGKPEEYNAHPHRDASGRLAVVQNGIIENYRELREELKTKGYVF
TSDTDTEVIPHLIADFLKTSAPDPDGHHHGLLDAVRQAVQHLQGAFAIAVISADFPDELV
VARQQAPLVLGFGEGEFFCASDTPALVPYTQAVLPLENGEIACLSPTGAEIYDFSGQRLR
KTPRTLNWNPVLVEKQGFKHYMLKEIYEQPGVVRTCLEYYLRDDWQPNADFSPIKLNLPK
VLLADLEQVQILACGTSWHAGLVGKYLLEGLAQIPTSVQYASEFRYAPPPVTRHTLTIGV
TQSGETADTLAALELELHRRANLRPELQPRLLGITNRPESSLGHLVPEMIDTHAGIEIGV
AATKTFVAQLLAFYLLALDLAWQRQTLDNSRLGEIIDQLRQLPAQVEQILESQERYIETL
SHDFADTQDFIFLGRGINFPIALEGALKLKEISYIHAEGYPAGEMKHGPIALLDAKVPVV
TIAMPGSVFEKVLSNAQEARARDARLIGVTPMEEQDARDTFDALLPVPEVDELLSPILTV
IPLQLLAYHIAARRGLDVDQPRNLAKSVTVE
Download sequence
Identical sequences K9RVY1
WP_015125171.1.5248 gi|427713547|ref|YP_007062171.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]