SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427713624|ref|YP_007062248.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713624|ref|YP_007062248.1|
Domain Number 1 Region: 447-645
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.45e-54
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000523
Further Details:      
 
Weak hits

Sequence:  gi|427713624|ref|YP_007062248.1|
Domain Number - Region: 18-74
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00706
Family TolA 0.043
Further Details:      
 
Domain Number - Region: 329-436
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 0.0903
Family Bacterial photosystem II reaction centre, L and M subunits 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427713624|ref|YP_007062248.1|
Sequence length 665
Comment transmembrane sensor domain-containing protein [Synechococcus sp. PCC 6312]
Sequence
MTWRLKLSHVTQRLSPADWGQLLSGLVVLLATVISTGLIVGVRGLGGLESLELAAYDRLM
QLRPEPVPDPRILVVGITEADIQAQKTWPLPDQVYAELLAKLLVAQPRAIGLDIYRDLPL
PPGHTQLNQIFQDSDRIFAVTKIGDETHPTINAPSGLSPQQVGFNDVIVDAGGIVRRNIL
FLGGESGTLFSFSLRLALRYLQDEQIRPQANPRNSQEMQLGQTIFVALQPNSSAYVQADT
QGYQVMLNYRGNNAAITWVSLGDVLAGRFDPSLIRNRVVLIGTLAESGKDFFYTPFSSAL
QDEQRMPGVVIHAQMVSQFLDAGAGKKATFWYWSWPVELVWIALWAGLGSLLAWGFRQPW
LIGFGAVLSLGSLFGIAYGLFLHLGWIPLVPPALAFIISGASVITYTAQQAQQQRQMVMR
LLGQSTSPEIAATLWQRRNELLQDGRLPGQKLVATLLFTDLKGFSTISETMAPEDLLPWL
NDYLEKVADIVQAHQGVINKFTGDGIMAVFGVPIPRTTEAEIAQDAKNAVDCALALGESL
GELNQAWSRQGLPQVGMRIGIFTGPIVAGSLGSKTRLEYGVIGDSVNTASRLESVDKHRH
PTPCRILIAAETLAYVPDRYQVEAWGALELKGKEHKIQVYLVQGHRHPQSRPGLVSTPNA
QGHIN
Download sequence
Identical sequences K9RUT4
WP_015125248.1.5248 gi|427713624|ref|YP_007062248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]