SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427713805|ref|YP_007062429.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713805|ref|YP_007062429.1|
Domain Number 1 Region: 396-597
Classification Level Classification E-value
Superfamily HAD-like 0.00000000000000221
Family Predicted hydrolases Cof 0.067
Further Details:      
 
Domain Number 2 Region: 10-270
Classification Level Classification E-value
Superfamily SIS domain 0.000000000000912
Family double-SIS domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427713805|ref|YP_007062429.1|
Sequence length 650
Comment putative HAD superfamily hydrolase [Synechococcus sp. PCC 6312]
Sequence
MGKPYSTELKQLEDTYAAAISLNIDHLCTAVAASASLPLLAVGSGGSLTAAHFMSTLHQR
FAGKIAKVVTPLELIVAAPVTREIAVWCLSAGGSNPDIKAAFQTAVLREPKQLFAICTKT
GSPLSHLVSKHHYTGIFEFDLPSQKDGFLATNSLLAFFVLLARAYHRVFTVDNELPESLS
GLIYQGSTADEFKMRIEQKCFPLWERRSLTLLYSIPTQSAAVDIESKFVEAALGDVQHSD
YRNFAHGRHYWLAKRGNDTAVLSLGSDSERELIQATLQLLPPDIPVVKLHFTGGDTAVAI
KSLVACLYVVGSAGKQRGIDPGRPGVPLFGQRLYHLRALGTPSIIFGGTVDACETAIIRK
TGTLPNVLAAQGQLEFWYNAYQDFIQKLQSVSFSTVVFDYDGTLCDERDRFGSPEKNIAK
EISRLLRAGIIIGIATGRGKSVKKALREIIPNRYWKHVIVGCYNGADCGLLSDDNHPNTM
EKPCHELGVLAKVFQSNLKLVQLADLTVRSKQITVEPKQVLWSETVISLINQIVYETNSS
GARLVTSSRSIDVLGPGVSKRTVVEKARELSGEILNPQALCIGDRGKWPGNDFDLLSELF
SLSVDETSSDSETCWNLAPAGYRGAQATLGYLRSLQVKDDGLHFDLTQIR
Download sequence
Identical sequences K9RWH9
gi|427713805|ref|YP_007062429.1| WP_015125428.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]