SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427713835|ref|YP_007062459.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713835|ref|YP_007062459.1|
Domain Number 1 Region: 722-1109
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 1.31e-92
Family Chloroperoxidase 0.001
Further Details:      
 
Domain Number 2 Region: 3620-3738
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.41e-17
Family Pentraxin (pentaxin) 0.08
Further Details:      
 
Domain Number 3 Region: 2402-2509
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000023
Family Pentraxin (pentaxin) 0.087
Further Details:      
 
Domain Number 4 Region: 1613-1701
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000188
Family Cadherin 0.054
Further Details:      
 
Domain Number 5 Region: 4100-4152,4195-4365
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000196
Family Quinohemoprotein amine dehydrogenase B chain 0.051
Further Details:      
 
Domain Number 6 Region: 3955-4161
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0000222
Family Tricorn protease N-terminal domain 0.042
Further Details:      
 
Domain Number 7 Region: 1707-1749
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000392
Family Pre-dockerin domain 0.023
Further Details:      
 
Weak hits

Sequence:  gi|427713835|ref|YP_007062459.1|
Domain Number - Region: 2152-2171,2205-2386
Classification Level Classification E-value
Superfamily NHL repeat 0.00314
Family NHL repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427713835|ref|YP_007062459.1|
Sequence length 5212
Comment RHS repeat-associated core domain-containing protein [Synechococcus sp. PCC 6312]
Sequence
MVKLEGYRGSGLANGHLGYGLGDSLLGQESLTEDGGLGDLLKALTVGKGSSSTGLDRIQE
VNSATRSFEPLLLPSAGKLGLFPSLENVPQRNFSQGSKFEQIMGSISSFAPTDLLTGSTS
PLTLKDSLTGSTSYLSSTDLLTGRQSPIVLEPAGTTSPNPSSNQPLTIPGTGAAVVPPPM
GNLPSFTVQANGKVIINGSADFDGEPLNLVDDARIHAGTGFRINGNPVLPVRRDAAGNPL
EGTQGNPLIIDYGITVAPGYTVARANGTHYDGVLPPKVVPPQTITVPLHATLVSDVLDQV
PDNHTSIVLNQGSLKTAADWRRYIPPELSGQNQTPSSDIRVGGTAAQPVVVRVNQGDLVI
PAGVDLQHLVLIVESGDIRFQGKNHDLNEVVLIANRGSITLSDVRGEALDVLASDSITVK
NKVRLSGESLLASGSRRDSLKLTDVTTNTETDQLKVIAQGDIIYGGTSQIRGQLLSGNDI
TLSGHSTLYGSLQAKGDITFNGRSSIIGVPSLGMPPDTSPPTLDVALSNDTGSSPSDTLT
NDPSISGNVQDDRRLVSLKAGFAPTPVAQFIEIFPSVGVDGAFSLAPEQLASLYGGPLPD
GLHTLFLQATDATGNTSALQSVSFVLDTTAPAAPNFTLAPEFDTAPLGDHKTERDIVTLE
GQSEPGSIVRLQETDAVTTANTAGRFTFEAINLAVGDNPFTVIAVDAAGNQRIFEQILTR
ELPNNPDVVIDWNAVLLDTIRRDQTPPPLAARNMAMVHAAIYDAVNAIEQDYAVYQVDVA
APTGASAAAAAAAAAHQVLVNLYPLQKTALDHQLAVSLAEIADGTAENDGVAVGQQVAAA
ILDWRRQDGHDTVMAYTPTLEPGHWQPTPANYYGALYPQWPAVTPFVMTAGHQFRPAGPP
ELTSAEYITEFNQVKALGAKNSTVRTGEQTEIARFWADGTGTYTPPGHWNQITEQAAIDR
GYSLAENARLFALLNIGLADAGIAAWDAKYTYDFWRPVTAIRQADEDGNPSTIADPTWTP
LIVTPPFPEYVSGHSTFSGTAASILTSFFGQDYSFTSTSVGLPGVSRNFTNFSAAAQEAG
ISRIYGGIHFQSANEDGLAMGYSIGDYVVGNFLLPRFPSPQLQINLANDTAPLGTTNRDG
LTSDPTITGVVTGGSGISRLVARFDPSRPFGDITPTLVNGQFRLDSDQLASLNGAPLTDG
AYTLEIQGINAIGTALANTSIRFTLDTGSPTLSLKTPISGGDHSPTVRWIGTITDPGGVA
TTGRYVIDNQPAVSLNVVEGGFNQLLQSDLTAGAHHSVIEVFDQAGNVTTQRVDFTVGER
IQVAATGTQGWGIWTADQLTLGEQDSLLVQTTLEIELGQSAGSRKLQFDLAAQWDNQDTT
SASRDRLLVYLVDPQNPSQTLLDGGEPGTALFALTGTTAEFTPGLVRYDGTTVEIDLTSL
GNLSQGRLVFQMVNTDQDVNSVVQVGQLRNTVNPEGVASPIFPISYQRATPGPAVSLDRY
HLVNTVDVQLSRVRLDPTTGHYQADLQVRNTGTTALSRQMLVLFPDLPQGVTLVDASGTH
PAGAAYLNLRAAMPAGDLAPGATSLPIAIRLDNPQLRQFTLQAVVLTGPRDQPPQLADLG
NLAVIAGGRLEIPLVATDPEGDPVTLTLKAQGPLPSGRLTGANTLVFTPSPEQVGTYSFI
LVATSGSLQTSQDVTLTVNPDPITTTRISGQIQNTNQAPLAGVLVEVDGYQTLTDANGHF
TVELSGLPPNNTLKVFGNLIDGAAAGTDPGTVTYPFIAEKLPLVLEHEVYAGVNNVISRP
IYLPELDTANAVSIDPTQSITVTTTAIPGAAVTVAAGTLKDQKGELYTGKLSITEVPTNL
TPAALPANLAPDLVITIQPGEMVFVQPAPLSLPNLAGYAPGLQMDLWSINPITGEFDKVG
IGEVSADGRVINTVEGGIRNSSWHFFAPFAQPLVDPASNPFNLDPRCHESQATVPATSTV
ELHSGALVETHDLVSYQSLGMTRGLTLTYDSLRADARPILHFGYDNLNPAAITNAPERLK
LVTELTIHQKDFDYQVPGFTGGQFGLDGGENVWAIPASGGGVDAAMQADLRSLPSGQYDY
SLQAGVRLFVRDEFLGSSTTNQGTLIHVNSLNSPFGSGWGLAGLQELVENKDGSILFIDG
DGSELVFRATATGYDAPPGDFSTLVRLADGTFQRTMKDQTVYRFNSGNQLSLIRDPNGNE
TQYLYNTAQHLSQIVDPVGLITQFSYTGDRVSAITDSTGRITQLEYDAAGNLIRITDPDS
SQRTWGYDADHRMISEVDQRGNREEAFYDFAGRVTKAIRKDGSVVQIASVQTQGLSRPEA
TSNPLTTTTSTNLGLPISTYIDGNGNVIRTQLDQAGQSVLAVDGAGLLPSVRRNEENLIT
QNIDGKGNITWFTYDDKGNVQSVRDQQSEIGDALIFDGIDDYVTLNATDLIANSPNSTVE
AWVKFDRLSGTQTIYSEAGENGPRYKLEQVDGNLRFGIWRSDVPGNWQYVSAPVLGDLLA
NIATTPATADLVVSNVSAPTNASWGQNITVDWTVTNQGSYIANQDWYDSIYLSSDPFFDI
NDTFLSRNYVSAQTPLAPGASYSLSQSVSLPNDPNKPYVLVVTDRFYNDDRFGGNNQQVE
SNEANNIKVAAVVGVPDLVISNVSAPTNASWGQNMTVNWTVTNQGSYIANQDWYDSIYLS
SDPFFDINDTFLSRNYVSAQTPLAPGASYSLSQSVSLPNDPNKPYVLVVTDRFYNDDRFG
GNNQQVESNEANNIKVAAVVGVPDLVISNVSAPTNASWGQNMTVNWTVTNQGSYIANQDW
YDSIYLSSDPFFDINDTFLSRNYVSAQTPLAPGASYSLSQSVSLPNDPNKPYVLVVTDRF
YNDDRFGGNNQQVESNEANNIKVAAVVGVPDLVISNVSAPTNASWGQNMTVNWTVTNQGS
YIANQDWYDSIYLSSDPFFDINDTFLSRNYVSAQTPLAPGASYSLSQSVSLPNDPSKPYV
LVVTDRFYNDDRFGGNNQQVESNEANNIKVAAVVGSIAPGSSSLSDLVVTSLSAPEDATW
GQTIPISWTVTNQGVETATQAWSDYVYVSADEVFDITDTLVTLVARGSQTPLGIGASYTI
NQNVTIPLAATGKPYLLVFTDRDRQQAEMDDTNNIGTLEFLGDPDLTVTAATIPTDTSWG
QTVPISWTVTNQGEHLARSDWHDYVYASTDNTLDASDILISQAPIISQTPLAPGSSYTIN
QTVTIPSSTLGKPYLLFVTNRDREQRETDSSNNVKAVQTISPPDLVVADITTTQNGTWGE
PIAVSWTVVNQGAATAPGDWFDYLYVSADAVLDASDTVLGRFAVNSQTPLAPGASYTLNQ
TVTVPLSTTGKPFILVATDRDRQQVETNEANNTKAIATLDAPDLAVTNLTAPESATWGTP
IPVSWTVTNQSQYKALGNWTDYLYASSDAILDPTDILVASTPVNNAAPLAPGASYTLNQT
VTVPLTATGKPYLLLATDRDRQQVETHEANNIKALATLGAPDLVVTEIDAPPPPTWGSLI
PLSWSVTNQGTHTAAVTRWTDYVYASSDTVLDASDIIVGQTVISPTTPLEPGQSYNAAAT
ISLPTTAANKPYLLVVANADKGQIESNFSNNSLTPDQETSWIHVAAVLDQSAGLELYLNG
QRQAVNPLATRPTDAPISTASLSAPSTALQGQLDDVRLWNTARPRAELQANLRLVGNEAG
LIGYWPLDEGQGDTAFDQTPGAHHGTLVNGPNWAGEAAPLGRVLGNNLAGQQLVYREDFE
NGVGAEWSARAVDATHLNSFTRFSGRWSNSSQTLTLPTQTGVNYTLAFDFYALDSWEGSN
TTNGPDYFDVSVNGQLAFHETFSNISGFPQSFRSPDQGGASINLGFASFGDAIYRQIPIT
FTATGATTQIRFAANGLQGLADESWGIDNVRVTQAAIEPSSQLGQQHYTYDPVFNQLTSM
TDELGRQTLYEIDPTTGNRLSMTQVVGDVGGTDDVVTRYTYTAQGRVDLVTDPLGRIMNY
DYDSLGRLIRLTLAQGRPEQAQQHFSYDAAGNLISEINENGSRTEFRYDSLNRLTQVIES
DPDGAGPLTSPVTSFSYDAAGNLIQATDPRNHPTQYAYDPLNRLARAIDALGEETTYRYD
PAGNLASVTDALGHRTQYRYDARNRLSETSDPVGSRTTYRYDMADNLTAVIDPLGNRTSY
AYDARNRLIRETDALGQRTSYRYNPVDQLVAQTDRNGHQTRYEYDDLDRLSQMIDPLGGV
MRYTYDKVGNQLSSSDQLGRLTRYTYDNRNRLSQVIDPLEGRVSYQYDGVGNLLALTDQL
NRTTRYTYDPLERLTQVSDPLQQTTRYGYDPTGNLISLTDALNRTTSYQYDALNRRTTTI
NPLGDTATTDYDAVGNLTATTDELGRTTRLSYDARNWLTGITDPLGQTTVTQYDAMGNVV
ALTDALQQQTRYTYDMLYRVQQETDALGKATTYTYDPEGNLLSLTDSVNNTTTYAYDALD
RRVSDTNTLGHRRSYRYDAVGNQVGMTDRNGRRLSYSYDALDRQTTEQWLDGAGQPIYGL
SYTYDAASQLTTATDPTARYGYTYDLAGRLTRTDNAGTAGVPNVVFDYEYDAVNNLRFVR
DRINGQAAGIEEFSYDALNRTTRITQSGNGVSQKRVDMGYDKASQMTSLSRFGDLAGSQS
VAESEFTYDLGGRLTNLSHSHLETVLAAYGLTYDAANRITRISSVDGINDYTYDQRDQLL
GADYDYQGDEVYSYDENGNRTNPGYVTGVNNQLLSDGVYTYEYDQEGNRTRRTNIATGEV
TQYGWDYRNRLVGVVTKNSSGTITQQVTYTYDFENRRISKAVDSDRDGAAPAEVERFVYD
GDHIALVFDGQGNQIHRYLHGPQIDQVLAQEDAQGNTLWALSDHQGTVRDVVDEAGIPVN
HITYDSFGNATNQTNPTVYFRFGYTGREPDAETGLTYYRARYVDPRTGGFIGEDPIGFRA
GDTNLYRYVGNSPTNFTDPSGLQLSENPLSDLAGQVVSTWFMAGVAAWTAIGNSITTGNQ
GIGGSNNINFPGTVPPLKIPNHTGHGPIDRGAAGEALEGICRILRIPLPQVPGFPENPAE
GLVPPFLESNTINPDKQGRHIPGHRRFIPGRSELTHPNPQSLIDQFAGKGQAANKIPIGQ
PGSNERVDFGETIGNFVDQDTGIKIPTTIGTIRYSKKDVHIVPARPKSNELE
Download sequence
Identical sequences K9RWK0
gi|427713835|ref|YP_007062459.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]