SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427713879|ref|YP_007062503.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427713879|ref|YP_007062503.1|
Domain Number - Region: 16-50
Classification Level Classification E-value
Superfamily EF-hand 0.0817
Family Calmodulin-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427713879|ref|YP_007062503.1|
Sequence length 60
Comment hypothetical protein Syn6312_2897 [Synechococcus sp. PCC 6312]
Sequence
MQAKLEWLLRSGIIESYQINEKEVEIILFDQDSRKALYLTYQDFYRWASQFKEERNYQAS
Download sequence
Identical sequences K9RVJ8
gi|427713879|ref|YP_007062503.1| WP_015125502.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]