SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427713907|ref|YP_007062531.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427713907|ref|YP_007062531.1|
Domain Number - Region: 73-96
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00918
Family PhnA zinc-binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427713907|ref|YP_007062531.1|
Sequence length 125
Comment Hydrogenase-3 nickel incorporation protein HypA [Synechococcus sp. PCC 6312]
Sequence
MHETDMTKALILTVKDWWEAQPEKPQITKVHLTVGKFTCVEPMSLQFAFKVQTENTFLAG
AELVITEIPLIAFCHRCQEEYFPEMGQRYTCPNCGQPMEDIRSGRELKIERVEFSDSSPT
KQSLP
Download sequence
Identical sequences K9RX14
gi|427713907|ref|YP_007062531.1| WP_015125530.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]