SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427713982|ref|YP_007062606.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713982|ref|YP_007062606.1|
Domain Number 1 Region: 7-329
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.54e-113
Family TK-like PP module 0.00000000128
Further Details:      
 
Domain Number 2 Region: 342-534
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.56e-66
Family TK-like Pyr module 0.000000508
Further Details:      
 
Domain Number 3 Region: 539-671
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.84e-42
Family Transketolase C-terminal domain-like 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427713982|ref|YP_007062606.1|
Sequence length 671
Comment transketolase [Synechococcus sp. PCC 6312]
Sequence
MPVATTQSLEELCINSIRFLAVDAVEKAKSGHPGLPMGAAPMGFVLYDQFMRFNPKNPKW
FNRDRFVLSAGHGSMLQYALLYLTGYDSVTIDDIKSFRQWKSKTPGHPENFETAGVEVTT
GPLGQGIANAVGLAVAEAHLAATYNKPDCTLVDHYTYVILGDGCNMEGISGEAASIAGHW
GLGKLIALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHILHVENGNTDIAAIAKAIETAK
SVTDKPTMIKVTTTIGYGSPNKANTAGVHGAALGGDEVKLMRENLGWEFAPFDVPADALA
HMRKAIERGASYEAEWQSTYAQYKTKYPTEAAAFERQISGQLPANWDSVLPTYTAADKAL
PTRKNSETCLNKLAPVLPELIGGSADLTHSNLTELKGYGDFQKGQYQNRNIHFGVREHAM
GAICNGIALHGSGLIPYGATFLIFTDYMRAAIRLSALSEAGVIWVMTHDSIGQGEDGPTH
QPIETLASLRAIPNLTVIRPADGTEASGAYYVAITQAKEHKPTLLAFSRQNLPNLDTTSI
EGVTKGAYVVADCEGTPELILIGTGSELNLCITAAEKLTAAGKKVRVVSMPSFDLFEAQD
AAYKESVLPKAVTKRLSVEAASSFGWHKYIGTEGDTVSIDRFGASAPGGVVMEKFGFSVD
NVLAKAEALLG
Download sequence
Identical sequences K9RX71
WP_015125605.1.5248 gi|427713982|ref|YP_007062606.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]