SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427714084|ref|YP_007062708.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714084|ref|YP_007062708.1|
Domain Number 1 Region: 3-405
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.17e-75
Family AAT-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427714084|ref|YP_007062708.1|
Sequence length 410
Comment LL-diaminopimelate aminotransferase apoenzyme [Synechococcus sp. PCC 6312]
Sequence
MVAINENYLKLKAGYLFPEIARRVNAFSQLNPDAPIIRLGIGDVTEPLPEACRTAIIKAT
EEMGQRESFRGYGPEQGYAWLREKIATHDFQARGCDIEASEIFISDGSKCDNGNILDIFG
NTNRIAVTDPVYPVYVDTNVMAGHTGAANEKGEYEGLVYLPITAENDFTATIPSQKVDLI
YLCFPNNPTGAVASKAHLQAWVNYANKHGSIIFFDAAYESFITDPTIPHSIYEIPGARTC
AIEFRSFSKNAGFTGTRCALSVVPKTLEVTTSTGETVQLWSLWSRRQSTKFNGVSYIIQR
GAEAVYSPEGQSQTRGLVNFYMENACLIREKLGLAGFAVYGGENAPYVWLKTPNDLSSWE
FFDQLLTTCHVVGTPGSGFGAAGEGYFRISAFNSRENVETALARIVKAFG
Download sequence
Identical sequences K9RW32
WP_015125706.1.5248 gi|427714084|ref|YP_007062708.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]