SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427714110|ref|YP_007062734.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714110|ref|YP_007062734.1|
Domain Number 1 Region: 300-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-48
Family Ribonuclease PH domain 1-like 0.00000862
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-43
Family Ribonuclease PH domain 1-like 0.0000455
Further Details:      
 
Domain Number 3 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.18e-27
Family Ribonuclease PH domain 2-like 0.00099
Further Details:      
 
Domain Number 4 Region: 458-554
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.63e-26
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 563-648
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.66e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 6 Region: 626-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.48e-16
Family Cold shock DNA-binding domain-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427714110|ref|YP_007062734.1|
Sequence length 714
Comment polyribonucleotide nucleotidyltransferase [Synechococcus sp. PCC 6312]
Sequence
MTKLEKVIPLDGRDLHLTIGCFAPQADGAVLVRSGNTAVLVTATQAGTRDGIDFLPLTVD
YEERLYAAGRIPGGFLRREGRPPEKAILTGRLIDRPMRPLFPSWLRTDIQIVATTVSMDE
QVPPDVLAVTGASIAVLLGQIPFNGPMAAVRVGLVGDDFIINPTYAEIEAGDLDLVVAGT
DAGVVMVEAGANQLPEQDVIEAIDFGYEVVRDLIQAQRDLLAELGIPLIEVAAPTLDPTL
QDFIYQKAAGPIQEVLQRFEPKTIRDAALDEVQAAIGQDINALDETDPVYTAATASPKAL
PTLFKSVTKKLMRQQIIEKGVRVDGRKLDEVRPISCDVGVLPTRVHGTGLFNRGLTQVMS
VVTLGTPGDAQEMDDLHPDEEKRYLHHYNFPPYSVGEARPMRSPGRREIGHGALAERALI
PVLPPQQEFPYVIRVVSEVLSSDGSTSMGSVCGSTLALMDAGVPILKPVSGAAMGLIKEG
EEVRILTDIQGIEDFLGDMDFKVAGTETGITALQMDMKITGLPLDVITQAIQQARPARLH
ILEKMLACLPTSRSHLSPFAPRLISFKIEPELIGLVIGPGGKMIKSITEETGAKVDIQDD
GTVTVSAIDEDKAKRARSIIQGLTRKINTGDVFLGKVTRVIPIGAFVEFLPNKEGMIHIS
QLAEYRVGKVEDEVNVGDEVIVKIREIDPRGRVNLTRLGIHPDEAVAARTVVAE
Download sequence
Identical sequences K9RXC8
gi|427714110|ref|YP_007062734.1| WP_015125732.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]