SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427714382|ref|YP_007063006.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714382|ref|YP_007063006.1|
Domain Number 1 Region: 22-202
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.44e-71
Family HD domain 0.00000269
Further Details:      
 
Domain Number 2 Region: 191-407
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.11e-62
Family RelA/SpoT domain 0.0000243
Further Details:      
 
Domain Number 3 Region: 391-462
Classification Level Classification E-value
Superfamily TGS-like 2.83e-22
Family G domain-linked domain 0.076
Further Details:      
 
Domain Number 4 Region: 659-736
Classification Level Classification E-value
Superfamily ACT-like 0.00000000000666
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427714382|ref|YP_007063006.1|
Sequence length 760
Comment RelA/SpoT family (p)ppGpp synthetase [Synechococcus sp. PCC 6312]
Sequence
MNALAPPVPTDILVPDWLQACLLEPNADDGQSLICRAFTFAYDLHTGQKRASGEPYIAHP
VAVAGLLRDLGGGAALIAAGFLHDVIEDTVVTGEELEVQFGPEVRYLVEGVTKLSNFDFS
SKTERQAETFRHLFLAMAQDIRVIIVKLADRLHNMRTLEYLKPEKQIRIAQETKDIYAPL
ANRLGIWRFKWELEDLSFKYLEPEAYRKMQELVADKRAIREAQLQEALNLLQERMGTLGF
EHLEISGRPKHLYSIHQKMRRQQKEFHEIYDVAGIRVLVANKDECYRALAVVHDCFRSMP
GRFKDYISLPKPNQYQSLHTVVIGLGGQPLEVQIRTTEMHAVAENGIAAHWKYKETGGSQ
PNKWNARDEKFTWLRQLLDWQNDLKDAQEYLNSVRDDLFDNEVYVFTPQGDVKSLHQGAT
PVDFAYHIHTEVGNHCAGARINQRIVPLDTILRNGDIVDIITQKNAHPSLDWLNFVVTET
ARNRIRQWYKRSHREENIQRGRELLVNELGKSGLDALLKSARMQAVAERCNYQAVDDLLA
ALGYGEITLSLIVNRLRETAKSVEPDTQALINLTHSSPKVIPPPSGRASESPILGIEGLV
YHLAGCCSPVPGEPIIGVVTLGSRGISIHRQGCANAESIPGERLIPVRWNPQTKSNRPLT
YSVDVQIEVIDRVGILKDILIRLTDNRINVSNAQVKTFPGQTAIIDLSIDVTDAHQLDQT
FTQIKKITDVVSLRRRQQGTSGGSKSGADLTIPVEASAAL
Download sequence
Identical sequences K9RYD2
gi|427714382|ref|YP_007063006.1| WP_015126000.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]