SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427714637|ref|YP_007063261.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714637|ref|YP_007063261.1|
Domain Number 1 Region: 30-140
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.22e-18
Family 7-Fe ferredoxin 0.054
Further Details:      
 
Weak hits

Sequence:  gi|427714637|ref|YP_007063261.1|
Domain Number - Region: 86-97,233-313
Classification Level Classification E-value
Superfamily Fe-only hydrogenase 0.0759
Family Fe-only hydrogenase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427714637|ref|YP_007063261.1|
Sequence length 453
Comment Fe-S oxidoreductase [Synechococcus sp. PCC 6312]
Sequence
MSELPASLPVSAATYPPFLGFDNQSPPDPKLIDTCVHCGFCLATCPSYRVIGKETDSPRG
RIYLMDGINTAKVPLSPATVQHFDSCLGCLACVTTCPSGVAYDQLIAATRPQIERNHKRS
LGEQLLRTLIFTTFPYPQRLRVLLAPLWLYQKMGIQTLWRRSPLAKLLPKSLGAMEKMLP
PIPPQAWQDKFPTVIPAQGTKRFRVGFILGCVQRIFLPEVNEATVRVLTANGCEVVIPPS
QGCCAALSHHQGQEAQAQALARQMIDTFDQWDLDAVIINASGCGHTLKEYGHLLAEDPDY
ATPAQAFASKVKDVQEFLANVGLTAPLHPLQEDPLTLVYQDACHMIHGQKISLQPRQLLR
KIPGVTLREPIDAALCCGSAGVYNIFQPDVAAELGRQKVKNLTQTKADVIVSANVGCTLQ
IRQYLPEQHHTIPVYHPMQLLDWSIRQEQIPEN
Download sequence
Identical sequences K9RZ21
WP_015126255.1.5248 gi|427714637|ref|YP_007063261.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]