SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427714643|ref|YP_007063267.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714643|ref|YP_007063267.1|
Domain Number 1 Region: 585-849
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.62e-61
Family WD40-repeat 0.00037
Further Details:      
 
Domain Number 2 Region: 796-1075
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.03e-60
Family WD40-repeat 0.00018
Further Details:      
 
Domain Number 3 Region: 1024-1192
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-41
Family WD40-repeat 0.00015
Further Details:      
 
Domain Number 4 Region: 128-384
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-26
Family Phosphoribulokinase/pantothenate kinase 0.07
Further Details:      
 
Domain Number 5 Region: 543-579
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000103
Family Pentapeptide repeats 0.014
Further Details:      
 
Weak hits

Sequence:  gi|427714643|ref|YP_007063267.1|
Domain Number - Region: 15-57
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0654
Family Sigma3 domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427714643|ref|YP_007063267.1|
Sequence length 1225
Comment WD40 repeat-containing protein [Synechococcus sp. PCC 6312]
Sequence
MEFEQGLEAVDNTVFQKTGRRLGQVERLVLTGCWQNKTYDEISEAAGYSLSYINRTVAPK
LWQTLSSVLEERVNKKNIRFCLERHWHNQRLAQTSSALPQANIPKPPLSPELWPSLSASS
SPESSPSIDQMVDWGEAMDVSLFYGRQQEISILSQWIVQDRCRLVGILGLGGMGKTVLSI
KLAQTVQDQFEAIIWRTVRNAPTLKNLLEDIIPLLSHQQQIQGDIGALLELFRQSRCLLI
LDNLETILDSRNAGRFRPDYEDYGELLRLGSETPHQSCILLTSRERPIEIGILASTEAKV
RLWRLEGSWEIAQAILQAKNIDSSLAVQQQLSSRYSHCPLILKIVATSIQDLFAGDVAAF
LEEDTLVFNGIRRLLDQQFQRLTPLELSVMYWLAIGREGLGLDVLLGLILTPLPKRKLLE
TLEALTNRCLIEKQANGYTQQPVVMEYVTDVLVEQVTAELLTGELNLFLSHALLQASSKD
YIRSTQIRLILQPIGINLQSQFPTAVSLHQHMHHILQQIRDTGPGASYGAGNLLNLMQTL
ELDLTGADFSGLTIAQADLQNARLHRVNFHQASFSYVLFAESFNSPYVSALSPDNRYLAM
TGPDGLVHMWDVTTGQRQLTLAAHQGLALGVAFSPTSEVLATASFDRTLKFWQIPTGVCL
QVISTPAPIWSGCYSIDGQLFFLGLEDGRIQVWDVNHNQGVQEFSAHEATVASLAIHPQG
TVLASSGYDRCIKLWHLPSRTCLYQLTAHSDNVWKVAFSPDGTVLATAGFDGVARLWDAA
GLDTIPDSPNLDSSQILPLPCRHTLSLHRGQLLGLSFSPDGSLVATAGQDSLIRLWQVST
GQPVATLAGHRDLIWSVVFSQDGQSLYSVSNNEIKFWSVAARLCERTLYGLSVTCRTLAI
HPAGTRLITGSNDRQIRLWDLISGHSPRILSGHTGPIICLTLCGDGSTLASIDDEGILKL
WDLETGICRHTCKTGLVALYVSGSHHSDFPFIAISSTAKVIQLWNYRTAELFRTLEIPKS
LGHPHVVTIHPHQPLIATGHHTGQLYLWHLTADQPHQTLSGQANKPWTIAFHPDQPLIAS
GGDDCTVSVWNYQTNTALLTLVGHTAAVAWVAFNSDGRLVASGAGDNTVRIWDVTTGQCL
HTLTDHQAKVTAVAFSPRPLPGYDCPNLLISSSFDETIRLWDADTGTCLKILRPDRIYEG
MNLVNASGLTEAEKLTLQTLGAIIS
Download sequence
Identical sequences K9RZL8
WP_015126261.1.5248 gi|427714643|ref|YP_007063267.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]