SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712430|ref|YP_007061054.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712430|ref|YP_007061054.1|
Domain Number 1 Region: 407-604
Classification Level Classification E-value
Superfamily FtsH protease domain-like 2.88e-74
Family FtsH protease domain-like 0.00000248
Further Details:      
 
Domain Number 2 Region: 153-420
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.85e-73
Family Extended AAA-ATPase domain 0.0000000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427712430|ref|YP_007061054.1|
Sequence length 612
Comment membrane protease FtsH catalytic subunit [Synechococcus sp. PCC 6312]
Sequence
MNKRWRNAGLYVLLTIVVLALATAFFDRQPTTKVTWRYSELIQEVENHQVAKLNISPDRT
QAQAVTQDGTRVLVNLPPDPQLIDILTANNVDISVMPQNNDGFWFRALSSLLVPVALLVL
LFFLLRRAQGGAGNQAMSFGKSKARVQMEPQTQITFNDVAGIDQAKLELTEVVDFLKNAD
KFTEIGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSEFVEMFVGVGASRVRD
LFEQAKSNAPCIIFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLTEMDGFEGNTGIIIIA
ATNRPDVLDAALMRPGRFDRQVVVDRPDYKGRLEILKVHARGKTLAKDVDLDKISRRSPG
FTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVMAGPEKKDRVMSERRKTLVAYHE
AGHALVGALMPDYDPVQKVSIIPRGRAGGLTWFTPNEEQMDSGLYSRAYLQNQMAVALGG
RIAEEIVFGEDEVTTGASNDLQQVARVARQMITRFGMSDRLGPVALGRQNGNVFLGRDIM
AERDFSEETAATIDDEVRNLVDQAYRRAKDVLVSNRHVLDKIAEILITKETIDAEELQEI
LDSTEVKMAAIA
Download sequence
Identical sequences K9RSK3
gi|427712430|ref|YP_007061054.1| WP_015124055.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]