SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427712604|ref|YP_007061228.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712604|ref|YP_007061228.1|
Domain Number 1 Region: 219-383
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.94e-42
Family Histidine kinase 0.0011
Further Details:      
 
Domain Number 2 Region: 15-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.57e-25
Family KaiB-like 0.0013
Further Details:      
 
Domain Number 3 Region: 139-228
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000353
Family Homodimeric domain of signal transducing histidine kinase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427712604|ref|YP_007061228.1|
Sequence length 386
Comment signal transduction histidine kinase [Synechococcus sp. PCC 6312]
Sequence
MSSPDLFSVAVDGAESPLKLLLFVDQRPGIRERVQEIQAHLQSLPSPYGFDLKVISVCEH
PYLVEHFKLIATPALVKISPEPRQTLAGQKLLQKVDHWWPRWQQELESQANRGSAETGAM
AASLSYTTEFMRMADEIFQLTQDIESLRDHLKFKDRIISLLAHELRNPLTAVSLALETLD
NYWHPESETVTSEMEPATLDRLLHHARYQTTVIEHMITDLLLAARGSSSTLHIHPRKLDL
NHLCRGVLADLRDSFIQKKQKITTDLPSDIPPVHADRDRVRQVLVNILDNAHKYTPEGGQ
IHLSALHRTTQKVQVSISDTGPGIPREQQEKVFEEQYRLHANPEVDGYGIGLSLCREIIR
AHYGQIWVDSTGQGSNFQFTLPVYRG
Download sequence
Identical sequences K9RRV5
WP_015124229.1.5248 gi|427712604|ref|YP_007061228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]