SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspbr1|199310|gm1.9209_g from Aspergillus brasiliensis v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspbr1|199310|gm1.9209_g
Domain Number 1 Region: 614-807
Classification Level Classification E-value
Superfamily Sec7 domain 5.63e-64
Family Sec7 domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 125-235,358-465,939-986,1133-1260,1346-1456
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000017
Family Armadillo repeat 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspbr1|199310|gm1.9209_g
Sequence length 1583
Sequence
MSSSTPLPIAVDPVALVITECITVTSAMRKHARWAHSSVSAILGGGAVSRVYDRDTSAPP
SPRNGSTPPRPRSRMSSADEDHVLANRWGLRGKKGKSMQDNPLISAFARLRSDLKGCKDI
RSFDAPALLHPFLQVIRSSSTSAAITSLALVALTKFFAYNIISCDSPRLPMAMQLLSAAI
THCRFEASDSAADEIVLLRILKLMEGMLSRPEGELLGDESVCEMMETGLSMCCQVRLSEV
LRRSAEMAMVNMCQVIFMRLTHLEISETDETGSQAPLRAETEQTNLKMDPSVDGNTVTSQ
HPSAMGSDTGVTDRDRGSRDGSPEQMLNGSAVAAPPSPQDDTGDEVKPYSLPSIRELFRV
LIDLLDPHNRQHTEPMKVMALRIIDVALEVAGPSIAKHPSLATLAQDDLCRHLFQLVRSE
NIAILTASLRVAGTLLLTCRPVLKLQQELYLSYLVACLHPKVEIPKEPGINPALYDGVPQ
VPKLVKPSPSQTSSGRSTPVPVKDRQQLGLEGGSRKPETREAMVESIGVLARIPSFMVEL
FINYDCDVDRADLCEDMIGLLSRSAFPDSATWSTTNVPPLCLDALLGYVQFVYDRLDDEP
VHEGFPSIEHLRSQRRTKKLIIHAAQKFNEDPKAGIAYLASHGIIEDPSDPALVARFLKG
TTRLSKKILGEYLSKRNNEELLDAFVELFDFSGKTIVDALRDLLGAFRLPGESPLIERIV
TTFTEKYMQKAQPTQIADKDAAFVLTYAIIMLNTELYNRNIKSQNRMSCHDFSRNLRGVN
SGQDFAPEFLQEIYDSIKHNEIILPDEHDNQHAFDFAWRELLLKSSSAGELVVGETNIYD
AEMFAATWKPVVATLSYVFMSASDDAVYSRVVTGFDQCAQIAARYGLTDAFDRIVFCLSS
ISTLATNKPPSTALNTEVQAGQKSVMVSELAVKFGRDFRAQLAAVVLFRVLAGNEATVQQ
GWTYVARILSNLFINSLIPALDSNLTAELDISPIPLQTPSQVVDRDGRNTETGLLSAFTS
YLSSYAADEPPEPSDEELENTLCTVDCITACSTSDVLANIKSLPLETVSLVVEALLAQMP
EESAPAVIVVKPERPSAGTRASNGRTDGSKTNYDPGMMYLLELATVLTLRDSQTLEALGE
RLLTTLQAFIRDARNIHSMALSRIIHYLLNLLRLSHDQPFMRVPVILHGISGFDQDILES
VAVTVVNSLSRCISSPGLLRNEITVSPDFWSILQRLLPHKEAAPLVFDLLHSIVDSNPPI
ITADNYEAAVSLANDFISAGSVGYIEERQRDAHGRRGKAVKPSKPSENEVVSRGVKAISF
VLQLTRRVPSLIKQSHLEASEAWSAYWSPIFQSLTAQCINPCRDIRHHAVSALQRTLLSL
EISSTDEKEWTAIFDQVLFPLILRLLKPEVYHSDPLGMGETRVQVAILVCKIFLRYLDQL
PNRDGMLDLWLKILDILDRMMNSGQGDSLEEAIPESLKNILLVMADGGYLVPPAQDPSKE
PIWTETKKRLERFLPDLFKEIFPDASDEKSAPVSVAPSPVPSTPPAEPQDQTSTTTAEPP
ATSAAPAEAKAEEETEAPAAKQV
Download sequence
Identical sequences A0A1L9U976
jgi|Aspbr1|199310|gm1.9209_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]