SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Hetan1|171437|EuGene5000134 from Heterobasidion annosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hetan1|171437|EuGene5000134
Domain Number 1 Region: 4-96
Classification Level Classification E-value
Superfamily SIS domain 0.0000000000148
Family Phosphoglucose isomerase, PGI 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Hetan1|171437|EuGene5000134
Sequence length 104
Sequence
MLQQLYDTEKDQLVLNNLFAVDPARFSRDYKEHTAVSDSANTLLLDYFKNLIIQPVFATV
LDIVREAGGEQVRDKMFTGEHINTSENRGVLHVVLCSFGSLNTT
Download sequence
Identical sequences jgi|Hetan1|171437|EuGene5000134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]