SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|36321|estExt_Genewise1Plus.C_6_t10456 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|36321|estExt_Genewise1Plus.C_6_t10456
Domain Number 1 Region: 93-224
Classification Level Classification E-value
Superfamily Cap-Gly domain 5.5e-35
Family Cap-Gly domain 0.00015
Further Details:      
 
Domain Number 2 Region: 3-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.3e-18
Family Ubiquitin-related 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|36321|estExt_Genewise1Plus.C_6_t10456
Sequence length 244
Sequence
MALVSVWISSPDTHSERRISPHLSVSQLKFKLEPITGIPASTQSLTLRRTAADADVLAVL
DDDTKTLDSYGIREYMTIRVDSNDPHARGLAGQYTDDSHVDKFELTEEEYAARTDTVLQF
KKRNQLGRFAPPAPSSSAPRPSLPADLVPGARCEVALSPELSRRGTVRFVGPTEFGAKDE
SVWVGVEWDEPVGKGDGSVDGKRYFETAPLRASFVRPDKVKIGDYPELDPFADLDDDEED
EMEM
Download sequence
Identical sequences A0A194S4G4
XP_018271521.1.32311 jgi|Rhoba1_1|36321|estExt_Genewise1Plus.C_6_t10456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]