SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|42909|gm1.2474_g from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|42909|gm1.2474_g
Domain Number 1 Region: 88-140
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000000392
Family AN1-like Zinc finger 0.0042
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000099
Family Ubiquitin-related 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|42909|gm1.2474_g
Sequence length 152
Sequence
MHCFVRDLSGNSLSFDASTVHELQFALADRTGIPIPEQRLVYGSRQLVSTRDESLASFGI
VEGSTVGLALRLKGGAPKKRCTAMLSATDRCSQAAVRIVGDCQLCQAAFCSRHRLAEDHH
CPKLSDCREQAFLKNKTKLEAEATPSEKLARV
Download sequence
Identical sequences A0A194S7J9
jgi|Rhoba1_1|42909|gm1.2474_g XP_018272616.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]