SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|44032|gm1.3597_g from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|44032|gm1.3597_g
Domain Number 1 Region: 268-316
Classification Level Classification E-value
Superfamily BAG domain 0.000000000249
Family BAG domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|44032|gm1.3597_g
Sequence length 479
Sequence
MFAFAHPHSHSYSPSSPYTSRPTFLELVPSSLVYERHPHYHHSHDYLADQRRRQRQLALK
EAEAAERRRRIQEDLEVAAYRAAVAAEVEHRRRQAAYAREQRRRQDDRRRLVEARRARQR
HVHPYPRQLLDLVFQHLDAAALDDDEHADEHDESSDDDEQQLVHLVPLGAPDLSEHDEAS
AASSASDSASDLDMVALVDESDDDSDAEMASSPSRDSALSTLASLASEFASRRSAFTSPS
TLTFSPSPSPADRATRSPTPPLAFGRANAVFLGYEEALLALLTRIDAVESGGDDGVRRTR
KELVRAIEDELARLDGIKARAWEEQSGSSAGESDADDESTEHDADDAEDVLELSSSSDSD
IDTFPTSSTSHARRNASTKVPFVAPSSTSRHTRFASPALSSTSTSSSAADPVDEPLNAGS
DDVASLLLDVHKAHDEFDEMSDDERERLEMEALRAADRESDGDDKQDLDGDEEGVWVYC
Download sequence
Identical sequences A0A194S4T7
jgi|Rhoba1_1|44032|gm1.3597_g XP_018271574.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]