SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|46505|gm1.6070_g from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|46505|gm1.6070_g
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.13e-43
Family GABARAP-like 0.0000361
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|46505|gm1.6070_g
Sequence length 123
Sequence
MVRSKFKDEHVFEKRKAEAERIRAKYSDRIPVICEKADKTDIPVIDKKKYLVPADLTVGQ
FVYVIRKRIKLAPEKAIFIFVDEVLPPTAAMMSMIYEEHKDEDGFLYVTYSGENTFGSAF
EEI
Download sequence
Identical sequences A0A0P9EI21
XP_018268964.1.32311 jgi|Rhoba1_1|46505|gm1.6070_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]