SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|47487|gm1.7052_g from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|47487|gm1.7052_g
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.31e-21
Family Ubiquitin-related 0.00047
Further Details:      
 
Domain Number 2 Region: 275-338
Classification Level Classification E-value
Superfamily XPC-binding domain 3.92e-18
Family XPC-binding domain 0.00065
Further Details:      
 
Domain Number 3 Region: 355-411
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000266
Family UBA domain 0.002
Further Details:      
 
Domain Number 4 Region: 146-199
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000195
Family UBA domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|47487|gm1.7052_g
Sequence length 413
Sequence
MVKIQFKTLQQKQFFIEAEPTETVADLKKKIEADQGFPVDNQKIIFSGKVLPDDKTVADA
NFKPKDFCVVMVTKPKAAPAAAAAPAASAPAPATSAPAPTPAAVPQTPAQPTATPVAPNA
PGPAPAAAAPAATEAETPAPANVPSGDSSTSFIAGSALETSVNEMVAMGFPREQVQRAMR
ASFNNPHRAVEYLMTGIPETAPEPAPAPAAANPPGTPSPAAGNAAPLAATPAPAAAAATT
NAPRNLFEAAAAARSAPQQPAAAAAGAGAGAGANSGELGQLRNAPIMGQLRALVQQNPAL
LQPFLQQLGASNPELLTLIERNQQEFVEFLQEGVEEGEGVDALMDQFGDDEGGAGGAGGE
QYIQVTEEERAAIERLVGMGFDRQLVIQAFIACDKNEELAANYLLEHGFDFDD
Download sequence
Identical sequences A0A0P9F7X6
XP_018267832.1.32311 jgi|Rhoba1_1|47487|gm1.7052_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]