SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|47539|gm1.7104_g from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|47539|gm1.7104_g
Domain Number 1 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.08e-35
Family Ubiquitin-related 0.0000244
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.24e-34
Family Ubiquitin-related 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|47539|gm1.7104_g
Sequence length 154
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQ
Download sequence
Identical sequences A0A0P9GWN4
XP_018267883.1.32311 jgi|Rhoba1_1|47539|gm1.7104_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]