SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|53509|estExt_Genemark1.C_6_t10465 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|53509|estExt_Genemark1.C_6_t10465
Domain Number 1 Region: 276-326
Classification Level Classification E-value
Superfamily BAG domain 0.00000000863
Family BAG domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|53509|estExt_Genemark1.C_6_t10465
Sequence length 589
Sequence
MFAFPIHHPQPSVHSTSTTTARTQYERELERLAFLTQQHEQQRRRAEAAARQAALAAYVE
EQERRHREEAFERAVQQEVERRRLQQALEHRAALARRAQEERDAALYRQAVVEAAQRRAA
LVAREQHRRRVEAEQDHRRRIVEARRQQRARQSDFPHSLVQLFLDLVNSAAQNEPEQQAV
AAPALVVADKAASSSSPAPSSAAHAEPSLPDPAVEALQKRFERDAARQAALDTLNGLSTE
FDSRLSSFTSPSALTFQSPPSPTSTSSTPPLAFGKPNAGFLGHEDFLVSLLSKVDAVSSG
GDKVIKQARKALVKRVEVELAKLDELKEHEWERQSQQAASEAGEGSERPHDDSTAAAAPA
PSADTAVAEPESAKVESATASSPSSPTLDNSTPTPVDAPADQSTRLTAESLASLPTDAAN
PNPTVPRPRSRASTASLDSDTSSAVDRYVAEMLRRAKDLADRIDAEEEAEKAASAPAPAS
DESGSPAEATSVPPAAAEAVEAGALDEQAAVKAPSSRPAATEPLEDGVDEEIDVEGTLRR
KRSSSATVEPRASGVSSREGESAVRKEAVEEHEAEDVASEAGTEEFLVV
Download sequence
Identical sequences A0A194S4M9
XP_018271591.1.32311 jgi|Rhoba1_1|53509|estExt_Genemark1.C_6_t10465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]