SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|53517|estExt_Genemark1.C_6_t10474 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|53517|estExt_Genemark1.C_6_t10474
Domain Number 1 Region: 1208-1257
Classification Level Classification E-value
Superfamily BAG domain 0.0000000135
Family BAG domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|53517|estExt_Genemark1.C_6_t10474
Sequence length 1520
Sequence
MVVHSPVPGSYTVRYAATNHRDEPHVLVITRGFGDGDEARWPEQGPDMSLLGQDNDKQQQ
WRRTAAEVIAKDLGLMDETHQHWILDELPTGYGLFQQITHPKDAPAGSSGGAGKSKLRLD
RFIFGHNSKKIRSALSLGKHISNQVFGARSTCHCDGCKVTQPKASASSMADIGAPLRMAP
RKRKRTGEYAEIAGYASRADTGEPEGSTAAATTAAGGDDDGASTGTGTEREGSVAASGDS
PDKRPARKVRKSAAGARKRFAASGEDGDDYGEGAAGEESDYEEPSFTSTDYSRVGARTSS
GRRTKPSERLLSGMQQEARVQALTSVVKDAGVVDEFGENMAPAGKDVVVPSSLVSPAQVA
EDLAHPTLSRVGELVWVRVPLGPPPSGAPETAQLSRWPGIVRSRVVTPAASGVPRDEVYR
VELLGMSQQDVLEGVRSENVTPWTGYVPSNTAWLDQNPLVDDGLRAGQEKKRWAEIQAEG
WLGVANAFRKAQRIGKAYAAIQIRPIPTLVTGAHLASKPTVPPTSLAALERKGPESRYLS
HSHVIYGPELIHVGDYVRLCPYAELDPSIVASRTPHDASARLLPLTLVMRVSALYRGGKG
SPLVARGHVFEHKPVPGERDAALEPPRDESLQALPRAIVDTLPLPFPFHTWRLLAPAATE
PGSALETDVLVSQAVAGRYYPLGLAAMDPPPSRDETTKVINAWLEEASNGLGVWQDGRGA
KGGKGEEGIKALTLLLSGVAAGERAPRIVASKHLAGSRVEQYIVAEEQALGRPHKLGEAA
LGAEDRRPGDKQVIEPAAAAAVEPAPTSAPAPAPASAPAPAPAPASASAPAPAPAPAPKP
ASTPKAAPAKPAASTATAPWPAPAPKPKLVASAAPVKATTDRTAKGKSRASREVAQLIED
EERRTEAAKQAREREREKRRREGKLAHFAAMFAFPIHHPRPSVHSTSTTTARTQYERELE
RLAFLTQQHEQQRRRAEAAARQAALAAYVEEQERRHREEAFERAVQQEVERRRHLQQALE
HRAALARRAQEERDAALYRQAVVEAAQRRAAFVAREQHRRRVEAEQDQRRRIVEARRQQR
ARQSDFPQSLVQLFLDLANSAAHDEPEQQAVAPPAPVVGNEAASSSSPAPSSAAHAEPAL
PDPAVEALQKRFERDAARQAALDTLNALSTEFDSRLSSFTSPSALTFQSPPSPTSTSSTP
PLAFGKPNAAFLGHEDFLVSLLSKVDAVSSGGDKVIKQARKALVKRVEVELAKLDELKEH
EWERQSQQAASEAGEGSERAHDDSTAAAAPARSADTAVAEPESATVEPATASSSSSPTRD
NSTLAPVDAPVDQSIRLTAESLASLPTGTADPNPTTSRPCSRASTTSLASDTSSAVDRYV
AEMLRRAKDLADRIDAEEEAEKAASASTPTSGASGSPAEAISAPPAAAEAVESGAQDGQA
PAKAPSSAPVATEPLEDGVDEEIDVEATLRLKRSSPATAEPRTSDVSAKEEERAVRKEAV
EEHEADDVASEAGTEEFLVV
Download sequence
Identical sequences A0A194S817
jgi|Rhoba1_1|53517|estExt_Genemark1.C_6_t10474 XP_018271600.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]