SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|53532|estExt_Genemark1.C_6_t10489 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|53532|estExt_Genemark1.C_6_t10489
Domain Number 1 Region: 282-333
Classification Level Classification E-value
Superfamily BAG domain 0.0000000186
Family BAG domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|53532|estExt_Genemark1.C_6_t10489
Sequence length 563
Sequence
MFSLPLHQPQTNLYSTSSHKARLAYEQELKRLAFLTEQHEQQRRRAEAAARQAALAAYVE
EQERRHREEAFERAVLQEVERRRRLQQAALVQQALEHRAALARRAQEERDAALYRQAVVE
AAQRRAALVAREQNRRRVEAEQDQRRRIVEARRQQRARQSDLPHSLVQLFLDLASSAAHD
EPEQQAVAAPAPVVADKAASSSSPAPTSTATAEPSLPDPAIEALQKRFERDAARQAALDT
LNGLSTEFDSRLSSFTSPSALTFQSPPSPTSTSSTPTLAFGKPNAAFLGHEDFLVSLLSK
VDAVSSGGDKVIKQARKALVNRVEVELAKLDELKEHEWERQSQQAASEAGEGSERAHDDS
TAAAAPAPSADLAAAEPEPATVEPGTASSSSSPTLDNSTLAPVDAPVDQSARLTAESLAS
LPTDAANPHPTPSRPRSRASTTSLDSDSSSIVNLYVDEVLRRAKDLADRIDAEEEAEKAA
AAAAPARASDGSATVDGEGSARTSAAENVAQAASAPAAPVSTAPAATKPLEKDLKEKLVV
EATPKLELAPTSAVVADEERRAT
Download sequence
Identical sequences A0A194S832
jgi|Rhoba1_1|53532|estExt_Genemark1.C_6_t10489 XP_018271615.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]