SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|56019|estExt_Genemark1.C_160089 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|56019|estExt_Genemark1.C_160089
Domain Number 1 Region: 48-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.36e-26
Family APG12-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|56019|estExt_Genemark1.C_160089
Sequence length 134
Sequence
MSALSPAVTPGPSPALGAPPPHLAQAAQGGKLSPRQALDATKQKDLTKVVVRFKATGNAP
IMKQNFYKITASNQFRTVIAFLRKELGWKPADSLFLYINSSFSPAPDDTVANLFKCFGTE
GHLIVNYSSTQAWG
Download sequence
Identical sequences A0A0P9GH11
jgi|Rhoba1_1|56019|estExt_Genemark1.C_160089 XP_018268245.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]