SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|56202|estExt_Genemark1.C_170110 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|56202|estExt_Genemark1.C_170110
Domain Number 1 Region: 175-210,244-323
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-22
Family UBX domain 0.011
Further Details:      
 
Domain Number 2 Region: 6-44
Classification Level Classification E-value
Superfamily UBA-like 0.000000919
Family UBA domain 0.0098
Further Details:      
 
Weak hits

Sequence:  jgi|Rhoba1_1|56202|estExt_Genemark1.C_170110
Domain Number - Region: 60-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0298
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|56202|estExt_Genemark1.C_170110
Sequence length 323
Sequence
MSDRDTLISMGFSDTRVNKALKGTNNAGLGQALDFLEKHADEPESWWEAADEDEDEEGAP
TGVDDPEAKSLRCGECGKLFRNQALASYHSTKSGHTNFEESTEELKPLTEEEKAEKLREL
RAKMDEKRRVQAKLDAEENKRNEEIRRKSGKDEAQAREALKLKEAERAAVLRKKEKADEL
AARARIKEQIEADKRARAEKSAREKALREGRNPDIAAAAVSGGGAAPSAPLVPAASASSA
SGGEKKTYDAARLQIRVPSGPPLVHSLPATSTLGEVVEWVKGQTGLASVTLTCSFPRKTY
GAADLDKDLKSLNLVPSAVLLVQ
Download sequence
Identical sequences A0A0P9EFC2
jgi|Rhoba1_1|56202|estExt_Genemark1.C_170110 XP_018268123.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]