SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|56616|estExt_Genemark1.C_210090 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|56616|estExt_Genemark1.C_210090
Domain Number 1 Region: 52-124
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000468
Family Ubiquitin-related 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|56616|estExt_Genemark1.C_210090
Sequence length 184
Sequence
MQEIDRKPATTTAVAPHPPPFSGPPAPSSTSAALDATSTLSLKAAPVETGGGQGGAAELE
LLLLSGKRRRVQVSRAETVEQLIERVWSDWPAEWRASDPAPASASDLRLLHLGRFLEPES
TLSADAGLFSHAFDQDDTAKDARPTVVHLQIRTLRPPDAKPGGKVKAGTADDDDEACCAC
CVVS
Download sequence
Identical sequences A0A0N8PZ80
jgi|Rhoba1_1|56616|estExt_Genemark1.C_210090 XP_018267630.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]