SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|65470|fgenesh1_kg.12_#_20_#_isotig17136 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|65470|fgenesh1_kg.12_#_20_#_isotig17136
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.6e-26
Family Ubiquitin-related 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|65470|fgenesh1_kg.12_#_20_#_isotig17136
Sequence length 78
Sequence
MQIKIKTLTGKEIELDIEPSHTTQKIKEQLEEKEGIPPAQQRLIFLGKAMPDDKKAEDLK
VEAGSTLHLVLTLRGGRC
Download sequence
Identical sequences A0A0P9IUI3
XP_018269131.1.32311 jgi|Rhoba1_1|65470|fgenesh1_kg.12_#_20_#_isotig17136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]