SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|66893|estExt_fgenesh1_kg.C_140007 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|66893|estExt_fgenesh1_kg.C_140007
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.28e-16
Family Ubiquitin-related 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|66893|estExt_fgenesh1_kg.C_140007
Sequence length 99
Sequence
MSADENQADKKPETQHISLKIQGAGFPDLVIKVKKTTKLSKMMNAYCQRAGKALNEVRFM
YEGTRLNGDQLVADLDIEDIDEDEEVVIDVAQEAVGGSL
Download sequence
Identical sequences A0A0P9EGV9
XP_018268589.1.32311 jgi|Rhoba1_1|66893|estExt_fgenesh1_kg.C_140007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]