SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|18445|e_gw1.16.197.1 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|18445|e_gw1.16.197.1
Domain Number 1 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.5e-34
Family Ubiquitin-related 0.0000244
Further Details:      
 
Domain Number 2 Region: 152-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.81e-34
Family Ubiquitin-related 0.0000244
Further Details:      
 
Domain Number 3 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.69e-34
Family Ubiquitin-related 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|18445|e_gw1.16.197.1
Sequence length 231
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI
Download sequence
Identical sequences A0A0P9IS28
jgi|Rhoba1_1|18445|e_gw1.16.197.1 XP_018268253.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]