SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|55776|estExt_Genemark1.C_140212 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|55776|estExt_Genemark1.C_140212
Domain Number 1 Region: 238-325
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000291
Family UAS domain 0.043
Further Details:      
 
Domain Number 2 Region: 427-512,539-551
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000594
Family UBX domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|55776|estExt_Genemark1.C_140212
Sequence length 623
Sequence
MDQPLSSTQRAALEQLSAVTARSPDLGSDEARSSLELLRTSGWDVQTAVSRIYDGEGAPS
PNSSSAAAGARHAYPPTPDDDEPDVDDALLAGARNGSARRRGSGGTGGLGTGAVGLYYLR
QALAVPLTILSFPAALIYNLGALLLGLVARLFRLRGPSTTTLRPRNPFGHRAPRTILSPA
AAAEQWVKSIEEATGLSRQVDDAGSSTSGMQATSSSSTGLSARRRGSGLAPPGSGQRIPR
FLVGSYDAALRAARDDKRVLMVVLSSGENERDARFKRDVLCDEEVNRVLEEEDVLVWGGD
VGEREAFQVGQTLSYIALPFVAFVALQPSTPHSSNPATASTASPRLRLLTRLEHSPSAPL
TAASLHTHLVTLVLPRAEPYLARLRAQEVQRAADRLARDEAERRVNELARRDEEKVLAVR
RREEERRRAEREAHERAERAQVELRERERVAGLARRWRAWKRVELAGRPEGADVRVAVRL
GDGRRAMRGFSAEDGTDEVYGWVECELGAADDAAQARADGESEIERRAPPEGWQQQFHFR
LATTFPRQVIALAPHLAAPSSAASAAAAAATGERVTVGEAFQGLGKTVNLVVDGLEERRR
ASMSSREGNDSEDEEDEEEVESD
Download sequence
Identical sequences A0A0P9FAQ1
jgi|Rhoba1_1|55776|estExt_Genemark1.C_140212 XP_018268746.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]