SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MCYG_00393T0 from Microsporum canis CBS 113480

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MCYG_00393T0
Domain Number 1 Region: 774-811,933-994,1114-1221
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.51e-17
Family Ankyrin repeat 0.0064
Further Details:      
 
Domain Number 2 Region: 136-171,199-219,376-530
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000387
Family Ankyrin repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 594-721,920-988
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000103
Family Ankyrin repeat 0.01
Further Details:      
 
Domain Number 4 Region: 738-826,853-908
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000589
Family Pseudo ankyrin repeat 0.041
Further Details:      
 
Domain Number 5 Region: 136-334
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000539
Family Ankyrin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MCYG_00393T0
Sequence length 1564
Sequence
MGVYMNMKFPRISRKDTVSSFSQQDKDAAEALARQKRLEAFSAKSHVFRRTPSKRSFKRD
ELYSAIDSAIRSDSSLGMLEYLLTQLRETKSKKSFFKTQEDPMALDMTDLLRLATEKRNS
SFLEILSPHVDQWGLDAALGLAVASMDLHCIKALLQNGADPNACHQQFITAVGNGHVAVV
EMLAGTEKKLDSACLDEALPVAVSIGSMRLIMCLLHNGANADTDQILETAVRAGRLDISA
ALVLASRPPSHVSLDCAAGVAYHSNNLSCEERDSLLELLLCAGANGDCVARALVSSVVAN
DKRSVSLIVSYNGNVTYNSCEAIIAAIKGGNLHLLDILFKGEIDPDAASIALSRVPEVAS
NLSQTKKLSLIAHFVKCGAYGNPLNQCLVDAVQKNERSLVDLLVQYNASVDYDDGHALRL
AISSGALPTFRKLMEGKPSQVTLGHCIGLLPSLQPRLQFTVAQDLLTAGARGEAVNKLLI
GAVQSEFPAEREQLIELLVSHGADVDAQNGNCLVQAVKIGDVIVLKLLLQGRPSSSSLSR
AVVPAVSLRDRILRFSILDLLLNSREASGPQINQELVTLLKENPLDIVAVNLFLDKGKAD
INSNNGEPIKQACRINDPELLKILLQHQPSVDALNAAFPVALSSQDTSARYKICNKLLAA
GANGEALDSGLVAVQQSPPADPRLIELLLSYGADINYNGGAVIQRAIDMSDERQLALLVS
RFPTTLTLTLGLERLLKIDTQKRNEMAKILLDASQNRIPEALDSLLAEAILLNKGDVTFL
KMIIQYGASVNYQQGAAILNSIKGRRFDVFSLLLDQQANQGTLEEAFKACWTLRGTERLS
YTSRVLEGGYKGDLLDAALLEVVEEAPCSHEAVKLLLTHGASVHYNRSQSLVHAAMAKDI
LTLGLLLEAVSDRAGVTYAFGKLISTDSSNWLTKTGYSTVELLLQNGASGEVLSLALIAA
IETSDSNPKSPNFVELFLQHKANVDYQDGRAITASISVGKPQLTKEILKSSTSSQNINAA
FLCIFSSDLTEDIAIELFDIFTKMNLDIQALNGNVWSSGDESGLHEPVTFQCLRKWPRGY
KLLGRLLEAGIHVDKPISYVIDEEHGFEQVSLLLWALLQPQQLISPYVFECLLKHGVASV
DRTPDVIRKLIQHGAVVSVMDKHGVTPLIHASRRGQLTTMRCLIDAGAMVDDGSLHEASR
ELQSSAVQLLLDHGHNPNFPSMLHDGRCALAELCLRAESPGTSLVKTRQTIDGLIAGKAD
LTIHSQGKPLIYHALDNPTSCISTTTALLASKMWRLINNDFNHYTCDGYVYSPSTYVARS
LAQSSSEYGPELLRILKANGCKDVFYKCDGPQPPDMVGAPPEVIAEEKRRKNRLQRMQEQ
EEDHQISLQRERDVADQQHQIMARTHQLRTLHDRETADERDAAAERSNKLQLRLEAESAS
QRQHFASQQHLADQEQLRMMNQLRLEASERQGRLQIENDKLMAHTQHNLLEAKMAVESRR
IKELEAANERQYHRDSDLLSRQERILADRKAFMTVPTAAPGDEGSGLSMPEPQRQLTYTG
SELD
Download sequence
Identical sequences C5FC82
XP_002850289.1.42340 MCYG_00393T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]