SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MCYG_04954T0 from Microsporum canis CBS 113480

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MCYG_04954T0
Domain Number 1 Region: 78-243
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.7e-18
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00049
Further Details:      
 
Domain Number 2 Region: 432-552
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000157
Family Pseudo ankyrin repeat 0.026
Further Details:      
 
Domain Number 3 Region: 525-611
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000017
Family Pseudo ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MCYG_04954T0
Sequence length 651
Sequence
MAVGVKQLFNGERLDANTTSKFKIMSPAHINSGPRDATPTATASYDGDESAYDIRLEDGI
MNGSDSPPLLGQIGQRSKRVLLSTSTPFADTIVRSLYRDPDVELRLIVPQGLKVGQNELE
TVKCYEDAPQRVTDTTSQPLRAQFNMTAASLADWADLLIISPMDAGTLGSMVCGLTTSLT
LTLLRGWDVSKSIILVPGMTARQWVAPITRRHLDDIQVFWPWVKVLPPILSKFEAPDRLV
ELPWDGRESFYDEVRKGLGWSVRVDSEDVPLHEVERHEKGDDQSRQNGTVLPVANLQTSH
NFSSQTTITQPTPTQPALPSELLSMIFEALGDWETAAAVGVYTRIPTPDQWKPLIPRSQS
SQCTLEYAILKRPFSEIEQYLSSASPWKPLSMLSAHLILKFSRIDILDFIIKSRSDIFWS
TPRLLNLPFRASAIYGNTALLDWWLHCTELPKKDYLTDAMDSASRAGFIHVLEWWRNSGL
PLLYTERALESASAEGHVAVLSWWRNASECSPEHALPLKVGKSVLLAAQSGKTNSIAWWD
QSGIPYSYTESVARIASTHGHVHVLELWYKLKGSKMIFDNQVLVGATKNGHVDVLEWWRR
SGLHVEFKTCDIEEALEDAITGAEERVRQWWERNGLNLGVGTSEWMKVKVL
Download sequence
Identical sequences C5FQI2
MCYG_04954T0 XP_002847217.1.42340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]