SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386859844|ref|YP_006272550.1| from Borrelia crocidurae str. Achema

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386859844|ref|YP_006272550.1|
Domain Number 1 Region: 63-131
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.71e-16
Family Extended AAA-ATPase domain 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|386859844|ref|YP_006272550.1|
Domain Number - Region: 11-46
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.002
Family ClpX chaperone zinc binding domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386859844|ref|YP_006272550.1|
Sequence length 133
Comment hypothetical protein Q7M_619, partial [Borrelia crocidurae str. Achema]
Sequence
MARSKSQKIEGCSFCGRTRAEAEGKIISAKSVAICFECSKICHNLFKEESDKPASNKAPR
GLPTPKQLKSHLDKYIIGQEDAKKVLSVAVYNHYKRIFKGSKRETGVELEKSNVLLVGPT
GSGKTLLAKKIGS
Download sequence
Identical sequences I0FD42
gi|386859844|ref|YP_006272550.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]