SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFDG_00119T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFDG_00119T0
Domain Number 1 Region: 4-218
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.26e-64
Family Glutathione peroxidase-like 0.000000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PFDG_00119T0
Sequence length 220
Comment | PFDG_00119 | Plasmodium falciparum (isolate Dd2) peroxiredoxin-6 (221 aa)
Sequence
MAYHLGATFPNFTATASNVDGVFDFYKYVGDNWAILFSHPHDFTPVCTTELAEFGKMHEE
FLKLNCKLIGFSCNSKESHDQWIEDIKFYGNLDKWDIPMVCDESRELANQLKIMDEKEKD
IKGLPLTCRCVFFISPDKKVKATVLYPATTGRNSQEILRVLKSLQLTNTHPVATPVNWKE
GDKCCILPSVDNADLPKLFKNEVKKLDVPSQKAYLRFVQM
Download sequence
Identical sequences A0A024V941 A0A024WU31 A0A0L0CVD3 A0A0L1IBP1 A0A0L7KBU8 A0A0L7LW13 Q8IAM2 Q9XXW9 W4IKF2 W4ITL0 W7F3R4 W7G832 W7JQP5 W7K6H5
gi|124512718|ref|XP_001349492.1| gi|23499261|emb|CAD51341.1| PFDG_00119T0 5833.PF08_0131-1 PFHG_02328T0 PF08_0131 XP_001349492.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]