SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFDG_00309T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PFDG_00309T0
Domain Number - Region: 136-190
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00224
Family spliceosomal protein U5-15Kd 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFDG_00309T0
Sequence length 205
Comment | PFDG_00309 | Plasmodium falciparum (isolate Dd2) hypothetical protein (206 aa)
Sequence
MLKSCKMLRILYFNKIITKGLCSKGFIYKRLCFRNFNSIIKSEKKVDNKYIYNVYKLNDI
YYNNLKIINTYDEFYNLIIKNEYFKDYTQIRNRFCKEKDDIINNENTCDDTLYSDKNIMG
KKNTILNDAANKRIEEDSDKNIINSNDLQVLYFGCYDNNNSIILFNKFKSIIEKNKKLQF
YFIDVNLCPQGSYYIVILFLYPQLC
Download sequence
Identical sequences A0A0L7LWH5
PFDG_00309T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]