SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFDG_00344T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFDG_00344T0
Domain Number 1 Region: 116-213
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.34e-30
Family Thioltransferase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFDG_00344T0
Sequence length 219
Comment | PFDG_00344 | Plasmodium falciparum (isolate Dd2) hypothetical protein (220 aa)
Sequence
MDFIKVEDQGKYIEGNKGYQLFYLNSSTSKEYGSHIDVLNMMLEDYSSVLKIYVINVVDD
NNKYEFQFYAKSQLIKSFVNTNIGSITSFLRKYMQTLSYEQDTEEKNKEKEREKQIIERI
QNLLKNNKIILFMKGTKTFPQCKFSNAVIFMLNSMKIKYETYNILEDQDIRAHLKIYSNW
PTYPQLYINTELIGGHDIIKSMYDNNELALIIPDDCFEE
Download sequence
Identical sequences A0A024VBJ0 A0A024VEZ5 A0A024WCK4 A0A024WV52 A0A024XDG6 A0A0L1I6R3 A0A0L7K8P4 A0A0L7LWT9 W4IM38 W4IT46 W7FJG6 W7FMJ7 W7JS49
PFHG_01236T0 PFDG_00344T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]