SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFDG_01121T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFDG_01121T0
Domain Number 1 Region: 7-117
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000946
Family Thioltransferase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PFDG_01121T0
Sequence length 121
Comment | PFDG_01121 | Plasmodium falciparum (isolate Dd2) hypothetical protein similar to dynein 14 kDa light chain (122 aa)
Sequence
MKRTDDKIYVDINNEEEYKNLFDDKNDILYIIDIYTRWCGPCIFTFEMINKIYKNNLIFS
ENVKLFSICAQTVSSLKNYDNNCKPFYIILKNGEIIQQIQGCNIPLIFSFIDEHLMNKKI
N
Download sequence
Identical sequences A0A024V0S8 A0A024VH15 A0A024VZP1 A0A024WH52 A0A024WZB8 A0A060S0M5 A0A0L0CTT8 A0A0L1I6P0 A0A0L7KDP0 A0A0L7LYS1 Q8IKL4 W4I7H2 W4IWU3 W7F0P0 W7FQK6 W7J517 W7JNK4
5833.PF14_0590-1 PFDG_01121T0 PFHG_03220T0 gi|124810114|ref|XP_001348764.1| gi|23497664|gb|AAN37203.1| XP_001348764.1.26446 XP_012765663.1.2076 PF14_0590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]