SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFDG_01573T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFDG_01573T0
Domain Number 1 Region: 7-48
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000622
Family Glutathione peroxidase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFDG_01573T0
Sequence length 49
Comment | PFDG_01573 | Plasmodium falciparum (isolate Dd2) glutathione peroxidase (50 aa)
Sequence
MHDENGTLKSIGWNFGKFLVDKNGEVVNYFSPKTNPLDLEKIIIQLLQK
Download sequence
Identical sequences A0A0L7M0B4
PFDG_01573T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]