SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFDG_01869T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFDG_01869T0
Domain Number 1 Region: 174-271
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.23e-26
Family Thioltransferase 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PFDG_01869T0
Sequence length 272
Comment | PFDG_01869 | Plasmodium falciparum (isolate Dd2) hypothetical protein (273 aa)
Sequence
MNKYIRAPNLIYICASLGIHSILFKKQKSPDNKNSYHIKDFIKLKNIIFLTSCEVTQDPK
EGGGKKNYDRYHNELFNNKINQNKVHIDNNELVNYFDELYEQSKNENIITKGEEEEVEFN
SSNVLLPFVEEHEHVKDKNDNDKCIKYEYVNDKCIKDEHGEFERVEENIKLSEDIINIIE
NILKKYNVVLFMKGTALNPYCKYSKQAIHILKLNKVKQIHTVNILDNQELRNALKIYSNW
PTFPQLYVNQKFIGGIDKLQELHDQNKIKDII
Download sequence
Identical sequences A0A024V9H8 A0A024WU93 A0A024XAC2 A0A0L0CSJ9 A0A0L1I7H5 A0A0L7KBV9 A0A0L7M6C0 O15800 W4IK92 W4J5F7 W7FQI0 W7JF10
PFHG_02580T0 PFDG_01869T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]