SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFDG_02800T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFDG_02800T0
Domain Number 1 Region: 81-167
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000626
Family Thioltransferase 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PFDG_02800T0
Sequence length 183
Comment | PFDG_02800 | Plasmodium falciparum (isolate Dd2) hypothetical protein (184 aa)
Sequence
MFCPFMFPLKIILIILFIKYNVVNGLLKTPCNFSLRNNIISERICNIKLPNLSYKNILFS
RYGRRRRRNMNPFLFIQFKEKKKLPHLLCFHSKDCEYCNSMEKLLTKLKEEEQVHILKLE
MYDNSYNFELLQQLDYNNLCGGLPYYYNLKTHYNICGATTYHNLRNWAIDKKCNPNEPPN
EEF
Download sequence
Identical sequences A0A024VCH1 A0A0L1IG16 A0A0L7KCV7 A0A0L7M2Y1 W4IKX2 W7FCA6
PFDG_02800T0 PFHG_02892T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]