SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFDG_02902T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFDG_02902T0
Domain Number 1 Region: 19-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.92e-19
Family Thioltransferase 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PFDG_02902T0
Sequence length 132
Comment | PFDG_02902 | Plasmodium falciparum (isolate Dd2) hypothetical protein (133 aa)
Sequence
MKCYEMINMIHINIYLEQSIYIELKNTGSLNQVFSSTQNSSIVIKFGAVWCKPCNKIKEY
FKNQLNYYYVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNEWVLVHTVEGANQNDIE
KAFQKYCLEKAK
Download sequence
Identical sequences A0A0L7K9X1 A0A0L7M2S5
PFHG_01438T0 5833.PFI0790w-1 PFDG_02902T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]