SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFDG_03986T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFDG_03986T0
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.6e-31
Family spliceosomal protein U5-15Kd 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFDG_03986T0
Sequence length 139
Comment | PFDG_03986 | Plasmodium falciparum (isolate Dd2) hypothetical protein (140 aa)
Sequence
MLYHLHSGWDVDQAILSEEERLVCIRFGHDYDPDCMKMDELLFKVVEDIKNFCVIYLVDI
TEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQEFIDIVETIFRGA
RKGRGLVISPKDYSTKYKY
Download sequence
Identical sequences A0A060S1E4 A0A0L7K7B2 A0A0L7M7Y9 A0A2I0BY60 Q8I5A5
PFL1520w PFHG_01024T0 5833.PFL1520w-1 PFDG_03986T0 gi|124806392|ref|XP_001350710.1| gi|23496837|gb|AAN36390.1| XP_001350710.1.26446 XP_012764181.1.2076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]