SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFDG_04088T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFDG_04088T0
Domain Number 1 Region: 924-1100
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 6.67e-82
Family Gametocyte protein Pfg27 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFDG_04088T0
Sequence length 1108
Comment | PFDG_04088 | Plasmodium falciparum (isolate Dd2) predicted protein (1109 aa)
Sequence
MLKKYIILIYIGVILNFITKNNNVVSVPEPFLSQNKDSFEEKKYTYGDNLQLGASTINTP
KTQSQENKDINKETKNTIIKKTNNFPSTLNEKFPHKIQLTNKENKEDEQNKENKKDEQNK
EDEQNKQNKEDEQNKQNKDKKNIVSNKLSGNNEQQNNSIPKSIQKPENCVKKQSNQFPRS
YPEFFEANFGPIDELMDETDYSSDDLEDQLNYGYRGIEHDIDETDYYIGSILGYCDFMNK
MKYQNTQIDNNKGKKTTNTMEKNKKNRDKKHSKKRKTKQNYKYKKENQNIENHIPQSKYK
QERIEILDDNGKELKSHKNIKEEKGGIEKTDTTNIADIKIKKEERETKDEKEKNIQQLVK
DVQLIKVGEETKDDEKEDKEGTDDEEDTDDEEDTDDEEDTSDEETTGDQENKEETEVDEK
KTEKAEEELEEDKEESEKDKEESEKDKEESEKDKEESEKDKEKTEEDEEKTEDEKGTEVY
KKETDVDEKKEKGEYGEGTDDEEDKEKEEDDEETKVEEKKTEKDEEGTDYEEDTDDSDKD
EETKVEEKKTERDEEETEEDEKETEGTDDEEDKVEETDLDDQEEDEEEDKEDDKEKDKED
DKEDEKEKDKEDDKEKYKEDDKEDDKEDDKEKDKEDNKEKDKEDNKEKDKEDDKEKDKED
DKEKDKEDNKEKDKEDNKEKDKEDDKEKHDKHVRRIKKKMKDDDYDESLKTKNYYPHNMT
FGQQQYFPYYNPLEQQNYQLHHIIKQQQNYHPHHIIKQQQNHNPHHILQEQEKHHPQGIP
KEQPYNNVPYILKKGLEPKTHNHVKEDQPNIKQGVVKGQEPHVDDMHNNTKEHKNFKNTT
DSPEKQIEHVYNNSPEKQIEHVYNNSPEKQIEHVYNNSPEKQIEHVYNNSPEKPARHTNN
ISLEKQNSHKYNVNIQDRHDPVYYKYEDMLKRDKDLFTIINNICELEFNSTNNYLMKIIN
NDKLKHNSLNDNEAILKEITKTQNELFSLKLPLEIKVSMALRISERLRAFVFDKDLTAYY
IKKLKDIFKLETEAAKNYYYYVKCQKTFSDKKRLVNNLDSIKLYYESQINKNFISIPKDK
IPTAIYRISNLVNDLIFLLPQSNANKAL
Download sequence
Identical sequences A0A0L7M8A1
PFDG_04088T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]