SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFDG_05211T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFDG_05211T0
Domain Number 1 Region: 82-121
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000492
Family PDI-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFDG_05211T0
Sequence length 122
Comment | PFDG_05211 | Plasmodium falciparum (isolate Dd2) predicted protein (123 aa)
Sequence
MPPINSLIKQSKNGKFTTKAVEEEVEFNSSNVLFPFVEEHEHVKDKNDEDKCIKYEYVND
KCIKDEHGEFQRGEENIKLSEDIINIIENIFKKYNVVLFMKGTALNPYCKYCLQAIHILH
TK
Download sequence
Identical sequences A0A0L7MA10
PFDG_05211T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]