SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFDG_02827T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFDG_02827T0
Domain Number 1 Region: 8-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000181
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFDG_02827T0
Sequence length 213
Comment | PFDG_02827 | Plasmodium falciparum (isolate Dd2) conserved hypothetical protein (214 aa)
Sequence
MCSNGVYQLKNILLRYSETGHSSRNVRFFLRYLLPEYKEENKHLNFEIHHEQYEEPKVIF
EYINNTKYEISLKDIKSKHIVDIINLYKDSAGNNDYLKHGGPKVYSNRRSIQGLWCPNIY
SELNAISYLKKKKKNNIKLPKYTRESLNLNHDVIKGYGRWGNENLFPKGFDQRYLKNIFC
FPFKDSLPKKMEQNNAVESKEAEINSFYKFYKN
Download sequence
Identical sequences A0A024V727 A0A024W8F6 A0A024X776 A0A0L0D3G9 A0A0L1IDS9 A0A0L7KDD2 A0A0L7M279 A0A2I0BQG8 Q8IJU5 W4IHZ2 W4J2S7 W7F759 W7G5J0
XP_001347382.1.26446 PFDG_02827T0 5833.PF10_0097-1 PF10_0097 gi|124802149|ref|XP_001347382.1| gi|23494961|gb|AAN35295.1| PFHG_02668T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]