SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFDG_04719T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFDG_04719T0
Domain Number 1 Region: 83-400,431-484
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.15e-85
Family Duffy binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 498-681,715-735
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-38
Family Duffy binding domain 0.008
Further Details:      
 
Weak hits

Sequence:  PFDG_04719T0
Domain Number - Region: 716-813
Classification Level Classification E-value
Superfamily ARM repeat 0.0449
Family Exportin HEAT-like repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFDG_04719T0
Sequence length 887
Comment | PFDG_04719 | Plasmodium falciparum (isolate Dd2) conserved hypothetical protein (888 aa)
Sequence
IYVSDAKDLLDRIGEKVYEEKVKNGDAKKYIEALKGNLNTANGRSSETASSIETCTLVKE
YYERVNGDGKRHPCRKDAKNEDVNRFSDTLGGQCTYNRIKDSQQGDNKVGACAPYRRLHL
CDYNLESIDTTSTTHKLLLEVCMAAKYEGNSINTHYTQHQRTNEDSASQLCTVLARSFAD
IGDIVRGKDLYLGYDNKEKEQRKKLEQKLKDIFKKIHKDVMKTNGAQERYIDDAKGGDFF
QLREDWWTANRETVWKALICHAPKEANYFIKTACNVGKGTNGQCHCIGGDVPTYFDYVPQ
YLRWFEEWAEDFCRKKKKKLENLQKQCRDYEQNLYCSGNGYDCTKTIYKKGKLVIGEHCT
NCSVWCRMYETWIDNQKKEFLKQKRKYETEISGGGSGKSPKRTKRAARSSSSSDDNGYES
KFYKKLKEVGYQDVDKFLKILNKEGICQKQPQVGNEKADNVDFTNEKYVKTFSRTEICEP
CPWCGLEKGGPPWKVKGDKTCGSAKTKTYDPKNITDIPVLYPDKSQQNILKKYKNFCEKG
APGGGQIKKWQCYYDEHKPSSKNNNNCVEGTWDKFTQGKQTVKSYNVFFWDWVHDMLHDS
VEWKTELSKCINNNTNGNTCRNNNKCKTDCGCFQKWVEKKQQEWMAIKDHFGKQTDIVQQ
KGLIVFSPYGVLDLVLKGGNLLQNIKDVHGDTDDIKHIKKLLDEEDAVAVVLGGKDNTTI
DKLLQHEKEQAEQCKQKQEECEKKAQQESRGRSAETREDERTQQPADSAGEVEEEEDDDD
YDEDDEDDDVVQEEEEEKEEGTVAEVTEVTEVVEETVTEQEGVKPCDIVDKLFEDDKSLK
EACGLKYGPGGKEKFPIGSVSHQVVSVLPLVERRRQYVCHLGDDDYT
Download sequence
Identical sequences A0A0L7M8M3
PFDG_04719T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]