SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sepmu1|150789|estExt_fgenesh1_kg.C_80321 from Septoria musiva v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sepmu1|150789|estExt_fgenesh1_kg.C_80321
Domain Number 1 Region: 32-91
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.00000000000017
Family Hydrophobin II, HfbII 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sepmu1|150789|estExt_fgenesh1_kg.C_80321
Sequence length 92
Sequence
MQFFALLTTAALAAAAPSVLETRGGEKVCASGAPYCCQLDVLGVAAVSCSDVPGSPKSVD
EFNKECKHTGLSAQCCEVGGIADLALLCTTPL
Download sequence
Identical sequences N1QJR4
jgi|Sepmu1|150789|estExt_fgenesh1_kg.C_80321 XP_016758910.1.6424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]