SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|70733328|ref|YP_263102.1| from Pseudomonas protegens Pf-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70733328|ref|YP_263102.1|
Domain Number 1 Region: 41-250
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.4e-45
Family Phospholipase D 0.015
Further Details:      
 
Domain Number 2 Region: 285-486
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.36e-29
Family Nuclease 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70733328|ref|YP_263102.1|
Sequence length 522
Comment phospholipase D [Pseudomonas protegens Pf-5]
Sequence
MNPIQAFTWLLLLSLGLGGCATREVPYQPSQALPARDSGFAQSIRAQAAPYQGRSGFRLL
PNSTEAFMARAELIRNAQSSLDLQYYIVHDGISTRMLVDELLKAADRGVRVRILLDDTTS
DGLDQIIATLAAHPQIQIRLFNPLHLGRSTGLTRAMGRLFNLSQQHRRMHNKLWLADNSV
AIVGGRNLGDEYFDAQPNLNFTDIDMFSVGPVAEQLGHSFDQYWNSALSRPIGEFLSSTP
SAKALDNTRLRLEESLQDSRRQNQALYRQLMTYQTQPRMDIWRKELIWAWNQALWDAPAK
VLAKGDPDPHLLLTTQLAPELSGVGKELIMISAYFVPGQPGLVYLTGRADAGVSVSLLTN
SLEATDVPVVHGGYAPYRKALLEHGVKLYELRRQPGERGGSGPHLFHSGSYKGSDSSLHS
KAMIFDRRKSFIGSFNFDPRSVLWNTEVGVLVDSPELAEHVRALALQGMAPALSYQVKLL
DGKLVWVTEDQGQLHSLGHEPGNWWRRFNAWLSTRIGLERML
Download sequence
Identical sequences A0A1K2A9X6 A0A2K4LKB8 Q4K3T1
WP_011064215.1.101844 WP_011064215.1.14038 WP_011064215.1.18072 WP_011064215.1.23266 WP_011064215.1.38500 WP_011064215.1.42693 WP_011064215.1.48506 WP_011064215.1.58641 WP_011064215.1.62026 220664.PFL_6044 gi|70733328|ref|YP_263102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]